Jump to content
 







Main menu
   


Navigation  



Main page
Contents
Current events
Random article
About Wikipedia
Contact us
Donate
 




Contribute  



Help
Learn to edit
Community portal
Recent changes
Upload file
 








Search  

































Create account

Log in
 









Create account
 Log in
 




Pages for logged out editors learn more  



Contributions
Talk
 



















Contents

   



(Top)
 


1 Background  





2 Crew  



2.1  Backup crew  





2.2  Support crew  







3 Mission parameters  



3.1  Agena docking  







4 Objectives  





5 Flight  



5.1  Agena and Gemini launch  





5.2  Rendezvous and docking  





5.3  Emergency  





5.4  Landing and recovery  







6 Thruster incident: cause and outcome  





7 Insignia  





8 Dramatizations  





9 Gallery  





10 Notes  





11 References  



11.1  Bibliography  







12 External links  














Gemini 8: Difference between revisions






Afrikaans
العربية

Български
Català
Čeština
Dansk
Deutsch
Eesti
Ελληνικά
Español
Esperanto
فارسی
Français
Galego

Italiano
עברית
Latviešu
Magyar
Nederlands

Norsk bokmål
Polski
Português
Русский
Slovenčina
Српски / srpski
Suomi
Svenska
Türkçe
Українська
Tiếng Vit

 

Edit links
 









Article
Talk
 

















Read
Edit
View history
 








Tools
   


Actions  



Read
Edit
View history
 




General  



What links here
Related changes
Upload file
Special pages
Permanent link
Page information
Cite this page
Get shortened URL
Download QR code
Wikidata item
 




Print/export  



Download as PDF
Printable version
 




In other projects  



Wikimedia Commons
 
















Appearance
   

 





Help
 

From Wikipedia, the free encyclopedia
 


Browse history interactively
 Previous edit
Content deleted Content added
A
Tag: Reverted
Rm unnecessary section with one fact already captured by an image caption. Update name of museum.
 
(17 intermediate revisions by 14 users not shown)
Line 1: Line 1:

{{Short description|Spaceflight in NASA's Gemini program}}

{{Short description|Spaceflight in NASA's Gemini program}}

{{Use American English|date=January 2014}}

{{Use American English|date=June 2024}}

{{Infobox spaceflight

{{Infobox spaceflight

| name = Gemini VIII

| name = Gemini VIII

| image = Gemini 8 docking.jpg

| image = Gemini8StationKeep.gif

| image_size = 300px

| image_caption = Gemini VIII docks with its [[Agena Target Vehicle]]

| image_caption = Gemini VIII rendezvous with its [[Agena Target Vehicle]] in a station-keeping exercise

| insignia = Ge08Patch orig.png

| insignia = Ge08Patch orig.png

| mission_type = {{Unbulleted list

| mission_type = {{Unbulleted list

Line 36: Line 37:

| docking =

| docking =

{{Infobox spaceflight/Dock

{{Infobox spaceflight/Dock

| docking_target = [[Agena target vehicle#Flight statistics|GATV-5003]]

| docking_target = [[Agena target vehicle#Flight statistics|GATV-5003]]

| docking_type = dock

| docking_type = dock

| docking_date = March 16, 1966, 23:14 UTC

| docking_date = March 16, 1966, 23:14 UTC

| undocking_date = March 16, 1966, ~23:45 UTC

| undocking_date = March 16, 1966, ~23:45 UTC

| time_docked = ~30 minutes

| time_docked = ~30 minutes

}}

}}

| crew_size = 2

| crew_size = 2

Line 68: Line 69:

| archive-date = 2010-01-13

| archive-date = 2010-01-13

| archive-url = https://web.archive.org/web/20100113132344/http://www.hq.nasa.gov/office/pao/History/SP-4203/toc.htm

| archive-url = https://web.archive.org/web/20100113132344/http://www.hq.nasa.gov/office/pao/History/SP-4203/toc.htm

| url-status = dead

}} With Gemini IV, NASA changed to Roman numerals for Gemini mission designations.</ref> was the sixth crewed spaceflight in [[NASA]]'s [[Project Gemini|Gemini]] program. It was launched on March 16, 1966, and was the 14th crewed American flight and the 22nd crewed spaceflight overall.{{efn|This count includes two [[X-15]] flights higher than the [[Kármán Line]] at {{convert|100|km|nmi mi ft|abbr=off|sp=us|0}}.}} The mission conducted the first docking of two spacecraft in orbit, but also suffered the first critical in-space system failure of a U.S. spacecraft which threatened the lives of the astronauts and required an immediate abort of the mission. The crew returned to Earth safely.

}} With Gemini IV, NASA changed to Roman numerals for Gemini mission designations.</ref> was the sixth crewed spaceflight in [[NASA]]'s [[Project Gemini|Gemini]] program. It was launched on March 16, 1966, and was the 14th crewed American flight and the 22nd crewed spaceflight overall.{{efn|This count includes two [[X-15]] flights higher than the [[Kármán Line]] at {{convert|100|km|nmi mi ft|abbr=off|sp=us|0}}.}} The mission conducted the first docking of two spacecraft in orbit, but also suffered the first critical in-space system failure of a U.S. spacecraft which threatened the lives of the astronauts and required an immediate abort of the mission. The crew returned to Earth safely.


Flown by pilot [[David Scott]] and command pilot [[Neil Armstrong]], the flight marked the second time a U.S. civilian flew into space and the first time a U.S. civilian flew into orbit.



==Background==

==Background==

Command pilot [[Neil Armstrong]] resigned his commission in the [[U.S. Naval Reserve]] in 1960.( On August 29, 1951, Armstrong saw action in the Korean War as an escort for a photo reconnaissance plane over Songjin.[23]) His flight marked the second time a U.S. civilian flew into space (after [[Joseph Albert Walker|Joe Walker]] on [[X-15 Flight 90]]),<ref name="Civilians in Space">{{cite web|url=http://www.fourmilab.ch/fourmilog/archives/2006-08/000736.html|title=Civilians in Space}}</ref><ref name="Space.com Joseph A Walker">{{cite web|url=http://www.space.cskjjsdhxdswjcgwdgcksdjagckhgskbdskjcbeiucbekhcbewiucgkhjabxcieuwgckhabckjsbdkjsgdkjsgdksabdmnsbckjebckndbiudbckjdsbcoeucbkdsbciuwedbckdsjbciugcbkdjbuwedbkjwebdieuwbxkjewdbueijbxkjecbiujbkjsdbcmn xmnbcnmdsbckwdjbcjdkgsdkjshjdkwsbxjkshkhdjkhdhhdhhdie8ejencienmbckdbclmsdbcljdwbcjrebocireibroivroibvblkwenckwdnclkewblkncdlenlkewnflekwnfeknfkwnefknemcdnreklnvirvhugvefiwukjhebgckjqwrxfiuwghuwertuidvkbwe, cm zx ,vsdbjwjfwohfydhdbc,bdcsbdwhlfrihhifjdcbm, xmcadmn.n.dkcz/Z?A

Command pilot [[Neil Armstrong]] resigned his commission in the [[U.S. Naval Reserve]] in 1960, and was selected as a crew member for Gemini 8 in September 1965. His flight marked the second time a U.S. civilian flew into space (after [[Joseph Albert Walker|Joe Walker]] on [[X-15 Flight 90]]),<ref name="Civilians in Space">{{cite web|url=http://www.fourmilab.ch/fourmilog/archives/2006-08/000736.html|title=Civilians in Space}}</ref><ref name="Space.com Joseph A Walker">{{cite web |url=http://www.space.com/adastra/adastra_joewalker_061127.html|title=Space.com Joseph A Walker |website=[[Space.com]] |date=27 November 2006 }}</ref>{{efn|The [[Soviet Union]] launched the first civilian, [[Valentina Tereshkova]] (also the first woman), into space aboard [[Vostok 6]] on June 16, 1963.<ref name="Valentina Vladimirovna Tereshkova">{{cite web |url=http://www.adm.yar.ru/english/section.aspx?section_id=74 |title=Valentina Vladimirovna Tereshkova |access-date=2010-05-04 |archive-url=https://web.archive.org/web/20110423074712/http://www.adm.yar.ru/english/section.aspx?section_id=74 |archive-date=2011-04-23 }}</ref>}} and the first time a U.S. civilian flew into orbit.

Q Union]] launched the first civilian, [[Valentina Tereshkova]] (also the first woman), into space aboard [[Vostok 6]] on June 16, 1963.<ref name="Valentina Vladimirovna Tereshkova">{{cite web |url=http://www.adm.yar.ru/english/section.aspx?section_id=74 |title=Valentina Vladimirovna Tereshkova |access-date=2010-05-04 |url-status=dead |archive-url=https://web.archive.org/web/20110423074712/http://www.adm.yar.ru/english/section.aspx?section_id=74 |archive-date=2011-04-23 }}</ref>}} and the first time a U.S. civilian flew into orbit.



==Crew==

==Crew==

{{Spaceflight crew

{{Spaceflight crew

|terminology = Astronaut

| terminology = Astronaut

|position1 = Command Pilot

| position1 = Command Pilot

|crew1_up = [[Neil A. Armstrong]]

| crew1_up = [[Neil A. Armstrong]]

|flights1_up = First

| flights1_up = First

|position2 = Pilot

| position2 = Pilot

|crew2_up = [[David R. Scott]]

| crew2_up = [[David R. Scott]]

|flights2_up = First

| flights2_up = First

}}

}}



Line 95: Line 92:

|position2 = Pilot

|position2 = Pilot

|crew2_up = [[Richard F. Gordon Jr.]]

|crew2_up = [[Richard F. Gordon Jr.]]

}} This became the prime crew on [[Gemini 11]].

|notes=This became the prime crew on [[Gemini 11]].}}


===Support crew===

===Support crew===

* [[Walter Cunningham]] (Cape CAPCOM)

* [[Walter Cunningham]] (Cape CAPCOM)

Line 126: Line 122:


===Agena and Gemini launch===

===Agena and Gemini launch===

[[File:Gemini 8 Atlas-Agena launch.jpg|thumb|The Agena Target Vehicle is launched into space on an Atlas rocket in preparation for Gemini 8]]

[[File:Gemini8AgenaLaunch.gif|thumb|The Agena Target Vehicle is launched into space on an Atlas rocket in preparation for Gemini 8.]]


Five months earlier, NASA had launched an [[Agena target vehicle|Agena Target Vehicle]] for [[Gemini 6]], but the [[Atlas-Agena]] launch failed when the Agena's engine exploded during orbital injection and the mission had to be rescheduled. The next attempt succeeded. Everything worked perfectly; the Agena put itself into a {{convert|161|nmi|km|adj=on}} circular [[orbit]] and oriented itself to the correct attitude for the docking.

Five months earlier, NASA had launched an [[Agena target vehicle|Agena Target Vehicle]] for [[Gemini 6]], but the [[Atlas-Agena]] launch failed when the Agena's engine exploded during orbital injection and the mission had to be rescheduled. The next attempt succeeded. Everything worked perfectly; the Agena put itself into a {{convert|161|nmi|km|adj=on}} circular [[orbit]] and oriented itself to the correct attitude for the docking.


[[File:Gemini 8 launch.jpg|thumb|upright|A [[Titan II GLV|Gemini-Titan]] launch vehicle lifts ''Gemini 8'' into orbit, March 16, 1966.]]

The Gemini spacecraft was launched into an {{convert|86|by|147|nmi|km|adj=on}} orbit by a modified [[Titan II GLV|Titan II]] on March 16, 1966 (coincidentally the 40th anniversary of the launch of the world's first liquid-fuelled rocket by Dr. [[Robert H. Goddard]]), at 10:41:02&nbsp;a.m. EST. Gemini 8's launch was nominal and no significant anomalies occurred with either the Titan II or the spacecraft.

[[File:Gemini8Launch.gif|thumb|A [[Titan II GLV|Gemini-Titan]] launch vehicle lifts ''Gemini 8'' into orbit, March 16, 1966.]]

The Gemini spacecraft was launched into an {{convert|86|by|147|nmi|km|adj=on}} orbit by a modified [[Titan II GLV|Titan II]] on March 16, 1966 (coincidentally the 40th anniversary of the launch of the world's first liquid-fueled rocket by Dr. [[Robert H. Goddard]]), at 10:41:02&nbsp;a.m. EST. Gemini 8's launch was nominal and no significant anomalies occurred with either the Titan II or the spacecraft.

{| class="wikitable plainrowheaders"

{| class="wikitable plainrowheaders"

|-

|-

Line 171: Line 170:


===Rendezvous and docking===

===Rendezvous and docking===

[[File:Gemini8Docking.gif|thumb|Gemini 8 docking with Agena vehicle]]

[[File:The First Docking in Space - GPN-2000-001344.jpg|thumb|left|The Agena Target Vehicle as seen from Gemini 8 during rendezvous.]]



Their first course adjustment was made at one hour and 34 minutes into the mission, when the astronauts lowered their apogee slightly with a five-second [[Orbit Attitude and Maneuvering System]] (OAMS) thruster burn. The second adjustment was made near apogee of the second orbit, and raised both the apogee and perigee by adding {{convert|49|ft/s|m/s}} to their speed. The third adjustment was made over the Pacific Ocean, a southward orbital plane change, made with a {{convert|59|ft/s|m/s}} sideways thruster burn. When they were over Mexico, [[Jim Lovell]], the Houston [[capsule communicator]], told them they needed one last correction, a {{convert|2.6|ft/s|m/s}} speed addition.

Their first course adjustment was made at one hour and 34 minutes into the mission, when the astronauts lowered their apogee slightly with a five-second [[Orbit Attitude and Maneuvering System]] (OAMS) thruster burn. The second adjustment was made near apogee of the second orbit, and raised both the apogee and perigee by adding {{convert|49|ft/s|m/s}} to their speed. The third adjustment was made over the Pacific Ocean, a southward orbital plane change, made with a {{convert|59|ft/s|m/s}} sideways thruster burn. When they were over Mexico, [[Jim Lovell]], the Houston [[capsule communicator]], told them they needed one last correction, a {{convert|2.6|ft/s|m/s}} speed addition.

Line 180: Line 179:


===Emergency===

===Emergency===

[[File:Gemini8Spin.gif|thumb|Gemini 8 spinning and undocking]]


There was some suspicion on the ground that the Agena's [[Spacecraft attitude control|attitude control]] system was malfunctioning and might not have the correct program stored in it. This suspicion was found to be incorrect. Shortly before radio blackout, [[Christopher C. Kraft Jr. Mission Control Center|Mission Control]] cautioned the astronauts to immediately abort the docking if any abnormalities occurred with the Agena.

There was some suspicion on the ground that the Agena's [[Spacecraft attitude control|attitude control]] system was malfunctioning and might not have the correct program stored in it. This suspicion was found to be incorrect. Shortly before radio blackout, [[Christopher C. Kraft Jr. Mission Control Center|Mission Control]] cautioned the astronauts to immediately abort the docking if any abnormalities occurred with the Agena.



After the Agena began execution of its stored command program, which instructed the Agena to turn the combined spacecraft 90° to the right, Scott noticed that they were rolling. Armstrong used the Gemini's OAMS thrusters to stop the roll, but after it stopped, it immediately started again. Gemini 8 was out of range of ground communications at this time.

After the Agena began execution of its stored command program, which instructed the Agena to turn the combined spacecraft 90° to the right, Scott noticed that they were rolling. Armstrong used the Gemini's OAMS thrusters to stop the roll, but after it stopped, it immediately started again. Gemini 8 was out of range of ground communications at this time.



[[File:Rcs-gemini.jpg|thumb|Location of Gemini OAMS and Reentry (mislabeled "Reaction") Control System thrusters]]

Armstrong reported that the OAMS fuel had dropped to 30%, indicating that the problem could be on their own spacecraft. With concern that the high rate of rotation might damage one or both spacecraft or even cause the propellant-heavy Agena to rupture or explode, the crew decided to undock from the Agena so they could analyze the situation. Scott switched the Agena control back to ground command, while Armstrong struggled to stabilize the combined vehicle enough to permit undocking. Scott then hit the undock button, and Armstrong fired a long burst of translation thrusters to back away from the Agena. Without the added mass of the Agena, Gemini started rotating more rapidly. The astronauts realized that the problem was on the Gemini. By now the tumble rate had reached 296 degrees per second and Armstrong decided to shut down the OAMS and use the Reentry Control System (RCS) thrusters, located on the Gemini's nose, to stop the tumble. From start to finish the incident lasted nearly 30 minutes.<ref>{{cite web|url=https://www.boeing.com/news/frontiers/archive/2006/march/i_history.html |title=Boeing Frontiers Online |publisher=Boeing.com |date=1966-03-16 |accessdate=2022-03-19}}</ref>

Armstrong reported that the OAMS fuel had dropped to 30%, indicating that the problem could be on their own spacecraft. With concern that the high rate of rotation might damage one or both spacecraft or even cause the propellant-heavy Agena to rupture or explode, the crew decided to undock from the Agena so they could analyze the situation. Scott switched the Agena control back to ground command, while Armstrong struggled to stabilize the combined vehicle enough to permit undocking. Scott then hit the undock button, and Armstrong fired a long burst of translation thrusters to back away from the Agena. Without the added mass of the Agena, Gemini started rotating more rapidly. The astronauts realized that the problem was on the Gemini. By now the tumble rate had reached 296 degrees per second and Armstrong decided to shut down the OAMS and use the Reentry Control System (RCS) thrusters, located on the Gemini's nose, to stop the tumble. From start to finish the incident lasted nearly 30 minutes.<ref>{{cite web|url=https://www.boeing.com/news/frontiers/archive/2006/march/i_history.html |title=Boeing Frontiers Online |publisher=Boeing.com |date=1966-03-16 |accessdate=2022-03-19}}</ref>



[[File:Rcs-gemini.jpg|thumb|Location of Gemini OAMS and Reentry (mislabeled "Reaction") Control System thrusters]]

NASA turned off the squawk box at Armstrong's home, alarming his wife. Scott later praised Armstrong's actions as their spacecraft spun: "The guy was brilliant. He knew the system so well. He found the solution, he activated the solution, under extreme circumstances ... it was my lucky day to be flying with him."<ref name="nova20141203">{{Cite episode |title=First Man on the Moon |url=http://www.pbs.org/wgbh/nova/space/first-man-on-moon.html |series=Nova |series-link=Nova (American TV series) |network=PBS |date=2014-12-03 |season=41 |number=23}}</ref> The spacecraft came in range of the ground communications ship ''[[Coastal Sentry Quebec]]''. After steadying the spacecraft, the crew tested each OAMS thruster in turn and found that Number 8 had stuck on. Almost 75% of the reentry maneuvering fuel had been used to stop the tumble,{{sfn|Gatland|1976|p=176}} and mission rules dictated that the flight be aborted once the Reentry Control System was fired for any reason. Gemini 8 immediately prepared for an emergency landing.



NASA turned off the [[squawk box]] at Armstrong's home, alarming his wife. Scott later praised Armstrong's actions as their spacecraft spun: "The guy was brilliant. He knew the system so well. He found the solution, he activated the solution, under extreme circumstances ... it was my lucky day to be flying with him."<ref name="nova20141203">{{Cite episode |title=First Man on the Moon |url=http://www.pbs.org/wgbh/nova/space/first-man-on-moon.html |series=Nova |series-link=Nova (American TV series) |network=PBS |date=2014-12-03 |season=41 |number=23}}</ref> The spacecraft came in range of the ground communications ship ''[[Coastal Sentry Quebec]]''. After steadying the spacecraft, the crew tested each OAMS thruster in turn and found that Number 8 had stuck on. Almost 75% of the reentry maneuvering fuel had been used to stop the tumble,{{sfn|Gatland|1976|p=176}} and mission rules dictated that the flight be aborted once the Reentry Control System was fired for any reason. Gemini 8 immediately prepared for an emergency landing.

===Landing and recovery===

[[Image:Armstrong and Scott with Hatches Open - GPN-2000-001413.jpg|thumb|Scott (L) and Armstrong (R) await USS ''Leonard F. Mason'']]



===Landing and recovery===

It was decided to let the spacecraft reenter one orbit later so that it could land in a place that could be reached by secondary recovery forces. The original plan was for Gemini 8 to land in the Atlantic, but that was supposed to be three days later. {{USS|Leonard F. Mason|DD-852|6}} started to steam towards the new landing site {{convert|800|km|nmi mi|sp=us}} east of [[Okinawa Island|Okinawa]] and {{convert|1,000|km|nmi mi|sp=us}} south of [[Yokosuka, Kanagawa|Yokosuka]], Japan.

It was decided to let the spacecraft reenter one orbit later so that it could land in a place that could be reached by secondary recovery forces. The original plan was for Gemini 8 to land in the Atlantic, but that was supposed to be three days later. {{USS|Leonard F. Mason|DD-852|6}} started to steam towards the new landing site {{convert|800|km|nmi mi|sp=us}} east of [[Okinawa Island|Okinawa]] and {{convert|1,000|km|nmi mi|sp=us}} south of [[Yokosuka, Kanagawa|Yokosuka]], Japan.



Line 197: Line 197:


Planes were also dispatched, and [[United States Air Force|U.S. Air Force]] pilot [[Les Schneider]] spotted the spacecraft as it descended precisely on time and on target. Three pararescuers jumped from their [[Douglas C-54 Skymaster|C-54]] and attached a flotation collar to the capsule.<ref name="Gemini 8 Crew and PJs">{{cite web |url=http://www.nasaimages.org/luna/servlet/detail/nasaNAS~7~7~32671~136538:Gemini-8-crew-stands-on-deck-of-rec |title=Gemini8 Crew and PJs |access-date=2010-06-15 |url-status=dead |archive-url=https://web.archive.org/web/20110727151042/http://www.nasaimages.org/luna/servlet/detail/nasaNAS~7~7~32671~136538%3AGemini-8-crew-stands-on-deck-of-rec |archive-date=2011-07-27 }}</ref>

Planes were also dispatched, and [[United States Air Force|U.S. Air Force]] pilot [[Les Schneider]] spotted the spacecraft as it descended precisely on time and on target. Three pararescuers jumped from their [[Douglas C-54 Skymaster|C-54]] and attached a flotation collar to the capsule.<ref name="Gemini 8 Crew and PJs">{{cite web |url=http://www.nasaimages.org/luna/servlet/detail/nasaNAS~7~7~32671~136538:Gemini-8-crew-stands-on-deck-of-rec |title=Gemini8 Crew and PJs |access-date=2010-06-15 |url-status=dead |archive-url=https://web.archive.org/web/20110727151042/http://www.nasaimages.org/luna/servlet/detail/nasaNAS~7~7~32671~136538%3AGemini-8-crew-stands-on-deck-of-rec |archive-date=2011-07-27 }}</ref>


[[File:Armstrong and Scott with Hatches Open - GPN-2000-001413.jpg|thumb|Scott (L) and Armstrong (R) await USS ''Leonard F. Mason'']]



All of the pararescuers and astronauts suffered from seasickness. Three hours after splashdown, the ''Leonard F. Mason'' had both men and the spacecraft on board. The astronauts were exhausted, but had otherwise survived the flight and their time on the water in good condition. They were briefly checked and slept for nine hours.

All of the pararescuers and astronauts suffered from seasickness. Three hours after splashdown, the ''Leonard F. Mason'' had both men and the spacecraft on board. The astronauts were exhausted, but had otherwise survived the flight and their time on the water in good condition. They were briefly checked and slept for nine hours.



The next morning, the ship docked at the port of [[Naha]]. Fellow astronaut [[Walter Schirra]] and other NASA officials flew in to greet them before the astronauts were summoned back to the ship for medical tests and debriefing. After release, they were brought by limousine to waiting helicopters where they flew to [[Kadena Air Base]] and then on to Florida on a [[Boeing C-135 Stratolifter|C-135]].<ref>[http://www.stripes.com/news/astronauts-arrive-on-okinawa-1.28085 Astronauts arrive on Okinawa] {{Webarchive|url=https://web.archive.org/web/20161220215913/http://www.stripes.com/news/astronauts-arrive-on-okinawa-1.28085 |date=2016-12-20 }} (March 19, 1966); AP, ''Stars and Stripes'', Retrieved: December 12, 2016.</ref>

The next morning, the ship docked at the port of [[Naha]]. Fellow astronaut [[Walter Schirra]] and other NASA officials flew in to greet them before the astronauts were summoned back to the ship for medical tests and debriefing. After release, they were brought by limousine to waiting helicopters where they flew to [[Kadena Air Base]] and then on to Florida on a [[Boeing C-135 Stratolifter|C-135]].<ref>{{Cite news |date=March 19, 1966 |title=Astronauts arrive on Okinawa |url=http://www.stripes.com/news/astronauts-arrive-on-okinawa-1.28085 |url-status=dead |archive-url=https://web.archive.org/web/20161220215913/http://www.stripes.com/news/astronauts-arrive-on-okinawa-1.28085 |archive-date=2016-12-20 |access-date=December 12, 2016 |work=Stars and Stripes |agency=Associated Press}}</ref>



Upon the return, the spacecraft was covered with a tarp. As part of the investigation into the mishap, ground controllers tested the Agena stage for the next several days by ordering it to perform various in-orbit maneuvers until exhausting its propellant and electrical power.

Upon the return, the spacecraft was covered with a tarp. As part of the investigation into the mishap, ground controllers tested the Agena stage for the next several days by ordering it to perform various in-orbit maneuvers until exhausting its propellant and electrical power.

Line 208: Line 210:

==Thruster incident: cause and outcome==

==Thruster incident: cause and outcome==

No conclusive reason for the thruster malfunction was found. The most probable cause was determined to be an electrical short, most likely due to a [[static electricity]] discharge. Power still flowed to the thruster, even when it was switched off. To prevent recurrence of this problem, spacecraft designs were changed so each thruster would have an isolated circuit.

No conclusive reason for the thruster malfunction was found. The most probable cause was determined to be an electrical short, most likely due to a [[static electricity]] discharge. Power still flowed to the thruster, even when it was switched off. To prevent recurrence of this problem, spacecraft designs were changed so each thruster would have an isolated circuit.


[[File:Press conference - GT-VIII - prime and backup crew.jpg|thumb|The Gemini 8 crews answer questions at an MSC press conference.]]

[[File:Press conference - GT-VIII - prime and backup crew.jpg|thumb|The Gemini 8 crews answer questions at an MSC press conference.]]


Quote from “Flight” by Chris Kraft, page 256:

Quote from "Flight" by Chris Kraft, page 256:

-Engineers tore into the OAMS system when the spacecraft got home and found a short circuit that made one thruster fire continuously. We learned an important lesson -never put electrical power to any system unless it’s supposed to be on. The OAMS was rewired so that a short circuit would always give us a dead thruster, not one that kept firing until a circuit breaker was opened by an astronaut.-

-Engineers tore into the OAMS system when the spacecraft got home and found a short circuit that made one thruster fire continuously. We learned an important lesson -never put electrical power to any system unless it’s supposed to be on. The OAMS was rewired so that a short circuit would always give us a dead thruster, not one that kept firing until a circuit breaker was opened by an astronaut.-



The Deputy Administrator of NASA, [[Robert Seamans|Dr. Robert Seamans]], was attending a celebratory dinner sponsored by the [[Goddard Space Flight Center]], at which Vice President [[Hubert Humphrey]] was the guest speaker, when the problem arose.<ref>{{Citation

The Deputy Administrator of NASA, [[Robert Seamans|Dr. Robert Seamans]], was attending a celebratory dinner sponsored by the [[Goddard Space Flight Center]], at which Vice President [[Hubert Humphrey]] was the guest speaker, when the problem arose.<ref>{{Cite journal

| last = Seamans Jr.

| last = Seamans Jr.

| first = Robert C.

| first = Robert C.

Line 221: Line 225:

| publisher = NASA

| publisher = NASA

| id = SP-2005-4537

| id = SP-2005-4537

| year = 2005

| date= 2005

| location = Washington, D.C.

| location = Washington, D.C.

| url = https://history.nasa.gov/monograph37.pdf

| url = https://history.nasa.gov/monograph37.pdf

}}

}}

</ref> The incident inspired Seamans to review NASA's problem investigation procedures, modeled after military crash investigations, and on April 14, 1966, to formalize a new procedure in ''Management Instruction 8621.1, Mission Failure Investigation Policy And Procedures''. This gave the Deputy Administrator the option of performing independent investigations of major failures, beyond those failure investigations for which the various Program Office officials were normally responsible. It declared: "It is NASA policy to investigate and document the causes of all major mission failures which occur in the conduct of its space and aeronautical activities and to take appropriate corrective actions as a result of the findings and recommendations."<ref>{{cite web

</ref> The incident inspired Seamans to review NASA's problem investigation procedures, modeled after military crash investigations, and on April 14, 1966, to formalize a new procedure in ''Management Instruction 8621.1, Mission Failure Investigation Policy And Procedures''. This gave the Deputy Administrator the option of performing independent investigations of major failures, beyond those failure investigations for which the various Program Office officials were normally responsible. It declared: "It is NASA policy to investigate and document the causes of all major mission failures which occur in the conduct of its space and aeronautical activities and to take appropriate corrective actions as a result of the findings and recommendations."<ref>{{cite web |last=Seamans Jr. |first=Robert C. |date=April 5, 1967 |title=NASA Management Instruction 8621.1 April 14, 1966 |url=http://www.hq.nasa.gov/office/pao/History/Apollo204/13.html |access-date=March 7, 2011 |work=Apollo 204 Review Board Final Report |publisher=NASA }}

| author = Dr. Robert C. Seamans Jr.

| title = NASA Management Instruction 8621.1 April 14, 1966

| work = Apollo 204 Review Board Final Report

| publisher = NASA

| date = April 5, 1967

| url = http://www.hq.nasa.gov/office/pao/History/Apollo204/13.html

| access-date = March 7, 2011}}

</ref> Seamans first invoked this new procedure immediately following the fatal [[Apollo 1]] spacecraft fire on January 27, 1967. It was also invoked after the next critical in-flight failure, which occurred on the [[Apollo 13]] lunar mission in April 1970.

</ref> Seamans first invoked this new procedure immediately following the fatal [[Apollo 1]] spacecraft fire on January 27, 1967. It was also invoked after the next critical in-flight failure, which occurred on the [[Apollo 13]] lunar mission in April 1970.



[[McDonnell Aircraft Corporation]], the Gemini spacecraft prime contractor, also changed its procedures. Prior to the accident, McDonnell's top engineers would be at [[Cape Canaveral Air Force Station|Cape Kennedy Air Force Station]] for the launch, then fly to [[Christopher C. Kraft Jr. Mission Control Center|Mission Control]] in [[Houston, Texas]] for the rest of the mission. The problem occurred while they were en route, so it was decided to keep McDonnell engineers in Houston for the entire mission.<ref>{{cite web|url=http://www.hq.nasa.gov/office/pao/History/SP-4203/ch13-6.htm|title=On The Shoulders of Titans - Ch13-6|access-date=2011-05-04|archive-date=2011-05-14|archive-url=https://web.archive.org/web/20110514044857/http://www.hq.nasa.gov/office/pao/History/SP-4203/ch13-6.htm|url-status=dead}}</ref>

[[McDonnell Aircraft Corporation]], the Gemini spacecraft prime contractor, also changed its procedures. Prior to the accident, McDonnell's top engineers would be at [[Cape Canaveral Air Force Station|Cape Kennedy Air Force Station]] for the launch, then fly to [[Christopher C. Kraft Jr. Mission Control Center|Mission Control]] in [[Houston, Texas]] for the rest of the mission. The problem occurred while they were en route, so it was decided to keep McDonnell engineers in Houston for the entire mission.<ref>{{cite web |url=http://www.hq.nasa.gov/office/pao/History/SP-4203/ch13-6.htm |title=On The Shoulders of Titans - Ch13-6 |archive-date=2011-05-14 |archive-url=https://web.archive.org/web/20110514044857/http://www.hq.nasa.gov/office/pao/History/SP-4203/ch13-6.htm }}</ref>



==Insignia==

==Insignia==

[[File:Gemini 8 Flown Fliteline Sterling Silver Medallion.jpg|thumb|Gemini 8 space-flown [[NASA space-flown Robbins medallions of the Apollo missions#Gemini mission space-flown Fliteline medallions|Fliteline Medallion]]]]

[[File:Gemini 8 Flown Fliteline Sterling Silver Medallion.jpg|thumb|Gemini 8 space-flown [[NASA space-flown Robbins medallions of the Apollo missions#Gemini mission space-flown Fliteline medallions|Fliteline Medallion]]]]

[[File:Gemini VIII Capsule.jpg|thumb|The Gemini 8 spacecraft is displayed at the [[Neil Armstrong Air and Space Museum]]]]

[[File:Gemini VIII Capsule.jpg|thumb|The Gemini 8 spacecraft is displayed at the [[Armstrong Air & Space Museum]].]]


The flight patch for the mission shows the whole spectrum of objectives that were hoped to have been accomplished on Gemini 8. The text at the bottom is composed of the zodiacal symbol for [[Gemini (constellation)|Gemini]], [[Image:Gemini.svg|12px]], and the [[Roman numeral]] for eight, VIII. The two stars are [[Castor (star)|Castor]] and [[Pollux (star)|Pollux]], which are in the constellation of Gemini, and are refracted through a prism to provide the spectrum. Armstrong and Scott both designed the flight patch.


The [[mission patch]] shows the whole spectrum of objectives that were hoped to have been accomplished on Gemini 8. The text at the bottom is composed of the zodiacal symbol for [[Gemini (constellation)|Gemini]], [[File:Gemini.svg|12px]], and the [[Roman numeral]] for eight, VIII. The two stars are [[Castor (star)|Castor]] and [[Pollux (star)|Pollux]], which are in the constellation of Gemini, and are refracted through a prism to provide the spectrum. Armstrong and Scott both designed the flight patch.



==Dramatizations==

==Dramatizations==

The Gemini 8 mission was dramatized in episode 1 "Can We Do This?", of the 1998 [[HBO]] [[miniseries]] ''[[From the Earth to the Moon (miniseries)|From the Earth to the Moon]]'', and in the 2018 Armstrong [[biopic]], ''[[First Man (film)|First Man]]''. The story of the mission is told from the point of view of a fictional mission controller in [[For All Mankind (TV series)|''For All Mankind'']] (Season 2, Episode 8).

The Gemini 8 mission was dramatized in episode 1 "Can We Do This?", of the 1998 [[HBO]] [[miniseries]] ''[[From the Earth to the Moon (miniseries)|From the Earth to the Moon]]'', and in the 2018 Armstrong [[biopic]], ''[[First Man (film)|First Man]]''. The story of the mission is told from the point of view of a fictional mission controller in [[For All Mankind (TV series)|''For All Mankind'']] (Season 2, Episode 8).



{{Clear}}

==Spacecraft location==

==Gallery==

The spacecraft is on display at the [[Neil Armstrong Air and Space Museum]], [[Wapakoneta, Ohio]].

<gallery class="center" widths="220">

File:Gemini 8 docking.jpg

File:Gemini 8 Atlas-Agena launch.jpg

File:Gemini 8 launch.jpg

File:The First Docking in Space - GPN-2000-001344.jpg

</gallery>



==Notes==

==Notes==

Line 262: Line 267:

| publisher = Macmillan

| publisher = Macmillan

| location = New York

| location = New York

| year = 1976

| date = 1976

}}

}}

* {{cite book

* {{cite book

Line 269: Line 274:

|last2 = Grimwood

|last2 = Grimwood

|first2 = James M.

|first2 = James M.

|year = 1977

|date = 1977

|title = On the Shoulders of Titans: A History of Project Gemini

|title = On the Shoulders of Titans: A History of Project Gemini

|series = NASA SP-4203

|series = NASA SP-4203

Line 281: Line 286:

}}

}}

* {{cite press release

* {{cite press release

|author=NASA

|title=Gemini 8 press kit

|title=Gemini 8 press kit

|publisher=NASA

|publisher=NASA

Line 287: Line 291:

|url=https://mira.hq.nasa.gov/history/ws/hdmshrc/all/main/DDD/25015.PDF

|url=https://mira.hq.nasa.gov/history/ws/hdmshrc/all/main/DDD/25015.PDF

|access-date=February 27, 2015

|access-date=February 27, 2015

|url-status=dead

|archive-url=https://web.archive.org/web/20120227064402/https://mira.hq.nasa.gov/history/ws/hdmshrc/all/main/DDD/25015.PDF

|archive-url=https://web.archive.org/web/20120227064402/https://mira.hq.nasa.gov/history/ws/hdmshrc/all/main/DDD/25015.PDF

|archive-date=February 27, 2012

|archive-date=February 27, 2012

|ref = {{SfnRef|NASA|1966}}

}}

}}



Line 296: Line 300:

==External links==

==External links==

{{Commons category|Gemini 8}}

{{Commons category|Gemini 8}}

* {{YouTube| pmaKXA5oDQ8 | ''Gemini 8, This is Houston Flight''}}

* A site about the U.S.S. ''Leonard F. Mason'' (DD-852) https://web.archive.org/web/20031210135304/http://www.west.net/~ke6jqp/dd852.htm

* U.S. Space Objects Registry https://web.archive.org/web/20140718101923/https://usspaceobjectsregistry.state.gov/Pages/Home.aspx

* [https://web.archive.org/web/20140802173529/http://www.maniacworld.com/Gemini-VIII-Docks.htm Gemini 8 Docks with Agena] Video

*{{YouTube| pmaKXA5oDQ8 | ''Gemini 8, This is Houston Flight'' }}



{{Gemini program}}

{{Gemini program}}

Line 307: Line 308:

{{DEFAULTSORT:Gemini 08}}

{{DEFAULTSORT:Gemini 08}}

[[Category:Spacecraft launched in 1966]]

[[Category:Spacecraft launched in 1966]]

[[Category:Project Gemini missions]]

[[Category:David Scott]]

[[Category:Human spaceflights]]

[[Category:Human spaceflights]]

[[Category:March 1966 events]]

[[Category:Neil Armstrong]]

[[Category:Neil Armstrong]]

[[Category:Project Gemini missions]]

[[Category:Space accidents and incidents in the United States]]

[[Category:Space accidents and incidents in the United States]]

[[Category:Spacecraft launched by Titan rockets]]

[[Category:Spacecraft launched by Titan rockets]]

[[Category:Spacecraft which reentered in 1966]]

[[Category:Spacecraft which reentered in 1966]]

[[Category:March 1966 events]]

[[Category:David Scott]]


Latest revision as of 03:51, 18 June 2024

Gemini VIII
Gemini VIII rendezvous with its Agena Target Vehicle in a station-keeping exercise
Mission type
  • Spacecraft docking
  • Extravehicular activity (failed)
  • OperatorNASA
    COSPAR ID1966-020A Edit this at Wikidata
    SATCAT no.2105
    Mission duration10 hours, 41 minutes, 26 seconds
    Distance travelled293,206 kilometers (158,319 nautical miles)
    Orbits completed6
    Spacecraft properties
    SpacecraftGemini SC8
    ManufacturerMcDonnell
    Launch mass3,789 kilograms (8,353 lb)
    Crew
    Crew size2
    Members
  • David R. Scott
  • Start of mission
    Launch dateMarch 16, 1966, 16:41:02 (1966-03-16UTC16:41:02Z) UTC
    RocketTitan II GLV, s/n 62-12563
    Launch siteCape Kennedy LC-19
    End of mission
    Recovered byUSS Leonard F. Mason
    Landing dateMarch 17, 1966, 03:22:28 (1966-03-17UTC03:22:29Z) UTC
    Landing site25°14′N 136°0′E / 25.233°N 136.000°E / 25.233; 136.000
    Orbital parameters
    Reference systemGeocentric
    RegimeLow Earth orbit
    Perigee altitude261 kilometers (141 nmi)
    Apogee altitude270 kilometers (150 nmi)
    Inclination28.9 degrees
    Period89.81 minutes
    EpochMarch 16, 1966[1]
    Docking with GATV-5003
    Docking dateMarch 16, 1966, 23:14 UTC
    Undocking dateMarch 16, 1966, ~23:45 UTC
    Time docked~30 minutes

    (L-R) Scott, Armstrong
    ← Gemini 6A
    Gemini 9A →
     

    Gemini 8 (officially Gemini VIII)[2] was the sixth crewed spaceflight in NASA's Gemini program. It was launched on March 16, 1966, and was the 14th crewed American flight and the 22nd crewed spaceflight overall.[a] The mission conducted the first docking of two spacecraft in orbit, but also suffered the first critical in-space system failure of a U.S. spacecraft which threatened the lives of the astronauts and required an immediate abort of the mission. The crew returned to Earth safely.

    Background[edit]

    Command pilot Neil Armstrong resigned his commission in the U.S. Naval Reserve in 1960, and was selected as a crew member for Gemini 8 in September 1965. His flight marked the second time a U.S. civilian flew into space (after Joe WalkeronX-15 Flight 90),[3][4][b] and the first time a U.S. civilian flew into orbit.

    Crew[edit]

    Position Astronaut
    Command Pilot Neil A. Armstrong
    First spaceflight
    Pilot David R. Scott
    First spaceflight

    Backup crew[edit]

    Position Astronaut
    Command Pilot Charles "Pete" Conrad Jr.
    Pilot Richard F. Gordon Jr.
    This became the prime crew on Gemini 11.

    Support crew[edit]

    Mission parameters[edit]

    Agena docking[edit]

    March 16, 1966

    Objectives[edit]

    Gemini VIII was planned to be a three-day mission. After being launched into an 87-by-146-nautical-mile (161 by 270 km) orbit, on the fourth revolution it was to rendezvous and dock with an Agena target vehicle, which had been earlier launched into a 161-nautical-mile (298 km) circular orbit. This was to be the first space docking in history. Four separate dockings were planned.[6]

    During the first docking, Pilot David Scott planned to perform an ambitious, two-hour-and-10-minute extra-vehicular activity (EVA), which would have been the first since Ed White's June 1965 spacewalk on Gemini IV. On a 25-foot (7.6 m) tether for one and a half revolutions around the Earth, Scott would have retrieved a nuclear emulsion radiation experiment from the front of the Gemini's spacecraft adapter, then activate a micrometeoroid experiment on the Agena. Then he was to move back to the Gemini and test a minimum-reaction power tool by loosening and tightening bolts on a work panel.[6]

    During the EVA, after Armstrong undocked from the Agena, Scott was to don and test an Extravehicular Support Pack (ESP) stored at the back of the spacecraft adapter. This was a backpack with a self-contained oxygen supply, extra Freon propellant for his Hand Held Maneuvering Unit, and a 75-foot (23 m) extension to his tether. He would practice several maneuvers in formation with the Gemini and Agena vehicles (separated at distances up to 60 feet (18 m), in concert with Armstrong in the Gemini.[7]

    The flight also carried an additional three scientific, four technological, and one medical experiment.[8]

    Flight[edit]

    Agena and Gemini launch[edit]

    The Agena Target Vehicle is launched into space on an Atlas rocket in preparation for Gemini 8.

    Five months earlier, NASA had launched an Agena Target Vehicle for Gemini 6, but the Atlas-Agena launch failed when the Agena's engine exploded during orbital injection and the mission had to be rescheduled. The next attempt succeeded. Everything worked perfectly; the Agena put itself into a 161-nautical-mile (298 km) circular orbit and oriented itself to the correct attitude for the docking.

    AGemini-Titan launch vehicle lifts Gemini 8 into orbit, March 16, 1966.

    The Gemini spacecraft was launched into an 86-by-147-nautical-mile (159 by 272 km) orbit by a modified Titan II on March 16, 1966 (coincidentally the 40th anniversary of the launch of the world's first liquid-fueled rocket by Dr. Robert H. Goddard), at 10:41:02 a.m. EST. Gemini 8's launch was nominal and no significant anomalies occurred with either the Titan II or the spacecraft.

    Gemini 8 Agena info
    Target vehicle GATV-5003
    NSSDC ID: 1966-019A
    Mass 3,175 kilograms (7,000 lb)
    Launch site LC-14
    Launch date March 16, 1966
    Launch time 15:00:03 UTC
    1st perigee 299.1 kilometers (161.5 nmi)
    1st apogee 299.7 kilometers (161.8 nmi)
    Period 90.47 m
    Inclination 28.86
    Reentered September 15, 1967

    Rendezvous and docking[edit]

    Gemini 8 docking with Agena vehicle

    Their first course adjustment was made at one hour and 34 minutes into the mission, when the astronauts lowered their apogee slightly with a five-second Orbit Attitude and Maneuvering System (OAMS) thruster burn. The second adjustment was made near apogee of the second orbit, and raised both the apogee and perigee by adding 49 feet per second (15 m/s) to their speed. The third adjustment was made over the Pacific Ocean, a southward orbital plane change, made with a 59 feet per second (18 m/s) sideways thruster burn. When they were over Mexico, Jim Lovell, the Houston capsule communicator, told them they needed one last correction, a 2.6 feet per second (0.79 m/s) speed addition.

    The rendezvous radar acquired the Agena Target Vehicle at a distance of 179 nautical miles (332 km). At 3 hours, 48 minutes and 10 seconds into the mission they performed another burn that put them in a circular orbit 15 nautical miles (28 km) below the Agena. They first sighted it when they were 76 nautical miles (141 km) away, and at 55 nautical miles (102 km) they gave the computer automatic control.

    After several small burns they were 151 feet (46 m) away and with no relative velocity. After 30 minutes of visually inspecting the Agena to make sure that it had not been damaged by the launch, they were given the go for docking. Armstrong started to move towards the Agena at 3.15 inches (8 centimeters) per second. In a matter of minutes, the Agena's docking latches clicked and a green light indicated that the docking had been successfully completed. "Flight, we are docked! Yes, it's really a smoothie," Scott radioed to the ground.

    Emergency[edit]

    Gemini 8 spinning and undocking

    There was some suspicion on the ground that the Agena's attitude control system was malfunctioning and might not have the correct program stored in it. This suspicion was found to be incorrect. Shortly before radio blackout, Mission Control cautioned the astronauts to immediately abort the docking if any abnormalities occurred with the Agena.

    After the Agena began execution of its stored command program, which instructed the Agena to turn the combined spacecraft 90° to the right, Scott noticed that they were rolling. Armstrong used the Gemini's OAMS thrusters to stop the roll, but after it stopped, it immediately started again. Gemini 8 was out of range of ground communications at this time.

    Armstrong reported that the OAMS fuel had dropped to 30%, indicating that the problem could be on their own spacecraft. With concern that the high rate of rotation might damage one or both spacecraft or even cause the propellant-heavy Agena to rupture or explode, the crew decided to undock from the Agena so they could analyze the situation. Scott switched the Agena control back to ground command, while Armstrong struggled to stabilize the combined vehicle enough to permit undocking. Scott then hit the undock button, and Armstrong fired a long burst of translation thrusters to back away from the Agena. Without the added mass of the Agena, Gemini started rotating more rapidly. The astronauts realized that the problem was on the Gemini. By now the tumble rate had reached 296 degrees per second and Armstrong decided to shut down the OAMS and use the Reentry Control System (RCS) thrusters, located on the Gemini's nose, to stop the tumble. From start to finish the incident lasted nearly 30 minutes.[9]

    Location of Gemini OAMS and Reentry (mislabeled "Reaction") Control System thrusters

    NASA turned off the squawk box at Armstrong's home, alarming his wife. Scott later praised Armstrong's actions as their spacecraft spun: "The guy was brilliant. He knew the system so well. He found the solution, he activated the solution, under extreme circumstances ... it was my lucky day to be flying with him."[10] The spacecraft came in range of the ground communications ship Coastal Sentry Quebec. After steadying the spacecraft, the crew tested each OAMS thruster in turn and found that Number 8 had stuck on. Almost 75% of the reentry maneuvering fuel had been used to stop the tumble,[11] and mission rules dictated that the flight be aborted once the Reentry Control System was fired for any reason. Gemini 8 immediately prepared for an emergency landing.

    Landing and recovery[edit]

    It was decided to let the spacecraft reenter one orbit later so that it could land in a place that could be reached by secondary recovery forces. The original plan was for Gemini 8 to land in the Atlantic, but that was supposed to be three days later. USS Leonard F. Mason started to steam towards the new landing site 800 kilometers (430 nmi; 500 mi) east of Okinawa and 1,000 kilometers (540 nmi; 620 mi) south of Yokosuka, Japan.

    Reentry took place over China, out of range of NASA tracking stations.

    Planes were also dispatched, and U.S. Air Force pilot Les Schneider spotted the spacecraft as it descended precisely on time and on target. Three pararescuers jumped from their C-54 and attached a flotation collar to the capsule.[12]

    Scott (L) and Armstrong (R) await USS Leonard F. Mason

    All of the pararescuers and astronauts suffered from seasickness. Three hours after splashdown, the Leonard F. Mason had both men and the spacecraft on board. The astronauts were exhausted, but had otherwise survived the flight and their time on the water in good condition. They were briefly checked and slept for nine hours.

    The next morning, the ship docked at the port of Naha. Fellow astronaut Walter Schirra and other NASA officials flew in to greet them before the astronauts were summoned back to the ship for medical tests and debriefing. After release, they were brought by limousine to waiting helicopters where they flew to Kadena Air Base and then on to Florida on a C-135.[13]

    Upon the return, the spacecraft was covered with a tarp. As part of the investigation into the mishap, ground controllers tested the Agena stage for the next several days by ordering it to perform various in-orbit maneuvers until exhausting its propellant and electrical power.

    Four months later, the crew of Gemini 10 rendezvoused with the inert Agena and astronaut Michael Collins retrieved its micrometeorite collector.

    Thruster incident: cause and outcome[edit]

    No conclusive reason for the thruster malfunction was found. The most probable cause was determined to be an electrical short, most likely due to a static electricity discharge. Power still flowed to the thruster, even when it was switched off. To prevent recurrence of this problem, spacecraft designs were changed so each thruster would have an isolated circuit.

    The Gemini 8 crews answer questions at an MSC press conference.

    Quote from "Flight" by Chris Kraft, page 256: -Engineers tore into the OAMS system when the spacecraft got home and found a short circuit that made one thruster fire continuously. We learned an important lesson -never put electrical power to any system unless it’s supposed to be on. The OAMS was rewired so that a short circuit would always give us a dead thruster, not one that kept firing until a circuit breaker was opened by an astronaut.-

    The Deputy Administrator of NASA, Dr. Robert Seamans, was attending a celebratory dinner sponsored by the Goddard Space Flight Center, at which Vice President Hubert Humphrey was the guest speaker, when the problem arose.[14] The incident inspired Seamans to review NASA's problem investigation procedures, modeled after military crash investigations, and on April 14, 1966, to formalize a new procedure in Management Instruction 8621.1, Mission Failure Investigation Policy And Procedures. This gave the Deputy Administrator the option of performing independent investigations of major failures, beyond those failure investigations for which the various Program Office officials were normally responsible. It declared: "It is NASA policy to investigate and document the causes of all major mission failures which occur in the conduct of its space and aeronautical activities and to take appropriate corrective actions as a result of the findings and recommendations."[15] Seamans first invoked this new procedure immediately following the fatal Apollo 1 spacecraft fire on January 27, 1967. It was also invoked after the next critical in-flight failure, which occurred on the Apollo 13 lunar mission in April 1970.

    McDonnell Aircraft Corporation, the Gemini spacecraft prime contractor, also changed its procedures. Prior to the accident, McDonnell's top engineers would be at Cape Kennedy Air Force Station for the launch, then fly to Mission ControlinHouston, Texas for the rest of the mission. The problem occurred while they were en route, so it was decided to keep McDonnell engineers in Houston for the entire mission.[16]

    Insignia[edit]

    Gemini 8 space-flown Fliteline Medallion
    The Gemini 8 spacecraft is displayed at the Armstrong Air & Space Museum.


    The mission patch shows the whole spectrum of objectives that were hoped to have been accomplished on Gemini 8. The text at the bottom is composed of the zodiacal symbol for Gemini, , and the Roman numeral for eight, VIII. The two stars are Castor and Pollux, which are in the constellation of Gemini, and are refracted through a prism to provide the spectrum. Armstrong and Scott both designed the flight patch.

    Dramatizations[edit]

    The Gemini 8 mission was dramatized in episode 1 "Can We Do This?", of the 1998 HBO miniseries From the Earth to the Moon, and in the 2018 Armstrong biopic, First Man. The story of the mission is told from the point of view of a fictional mission controller in For All Mankind (Season 2, Episode 8).

    Gallery[edit]

    Notes[edit]

    1. ^ This count includes two X-15 flights higher than the Kármán Line at 100 kilometers (54 nautical miles; 62 miles; 328,084 feet).
  • ^ The Soviet Union launched the first civilian, Valentina Tereshkova (also the first woman), into space aboard Vostok 6 on June 16, 1963.[5]
  • References[edit]

    1. ^ McDowell, Jonathan. "SATCAT". Jonathan's Space Pages. Retrieved March 23, 2014.
  • ^ Hacker, Barton C.; Grimwood, James M. (September 1974). "Chapter 11 Pillars of Confidence". On the Shoulders of Titans: A History of Project Gemini. NASA History Series. Vol. SP-4203. NASA. p. 239. Archived from the original on 2010-01-13. Retrieved 2013-09-26. With Gemini IV, NASA changed to Roman numerals for Gemini mission designations.
  • ^ "Civilians in Space".
  • ^ "Space.com Joseph A Walker". Space.com. 27 November 2006.
  • ^ "Valentina Vladimirovna Tereshkova". Archived from the original on 2011-04-23. Retrieved 2010-05-04.
  • ^ a b NASA 1966, p. 2.
  • ^ NASA 1966, pp. 3, 18–19, 40–43.
  • ^ NASA 1966, p. 3.
  • ^ "Boeing Frontiers Online". Boeing.com. 1966-03-16. Retrieved 2022-03-19.
  • ^ "First Man on the Moon". Nova. Season 41. Episode 23. 2014-12-03. PBS.
  • ^ Gatland 1976, p. 176.
  • ^ "Gemini8 Crew and PJs". Archived from the original on 2011-07-27. Retrieved 2010-06-15.
  • ^ "Astronauts arrive on Okinawa". Stars and Stripes. Associated Press. March 19, 1966. Archived from the original on 2016-12-20. Retrieved December 12, 2016.
  • ^ Seamans Jr., Robert C. (2005). "Project Apollo: The Tough Decisions" (PDF). Monographs in Aerospace History. 37. Washington, D.C.: NASA. SP-2005-4537.
  • ^ Seamans Jr., Robert C. (April 5, 1967). "NASA Management Instruction 8621.1 April 14, 1966". Apollo 204 Review Board Final Report. NASA. Retrieved March 7, 2011.
  • ^ "On The Shoulders of Titans - Ch13-6". Archived from the original on 2011-05-14.
  • Bibliography[edit]

    Public Domain This article incorporates public domain material from websites or documents of the National Aeronautics and Space Administration.

    External links[edit]


    Retrieved from "https://en.wikipedia.org/w/index.php?title=Gemini_8&oldid=1229679830"

    Categories: 
    Spacecraft launched in 1966
    David Scott
    Human spaceflights
    March 1966 events
    Neil Armstrong
    Project Gemini missions
    Space accidents and incidents in the United States
    Spacecraft launched by Titan rockets
    Spacecraft which reentered in 1966
    Hidden categories: 
    CS1: long volume value
    Articles with short description
    Short description is different from Wikidata
    Use American English from June 2024
    All Wikipedia articles written in American English
    Pages using gadget WikiMiniAtlas
    Wikipedia articles incorporating text from NASA
    Commons category link is on Wikidata
    Articles with NARA identifiers
    Articles with SNAC-ID identifiers
     



    This page was last edited on 18 June 2024, at 03:51 (UTC).

    Text is available under the Creative Commons Attribution-ShareAlike License 4.0; additional terms may apply. By using this site, you agree to the Terms of Use and Privacy Policy. Wikipedia® is a registered trademark of the Wikimedia Foundation, Inc., a non-profit organization.



    Privacy policy

    About Wikipedia

    Disclaimers

    Contact Wikipedia

    Code of Conduct

    Developers

    Statistics

    Cookie statement

    Mobile view



    Wikimedia Foundation
    Powered by MediaWiki