Big dynorphin is an endogenous opioid peptide of the dynorphin family that is composed of both dynorphin A and dynorphin B.[1][2] Big dynorphin has the amino acid sequence: Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-Lys-Arg-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr.[2] It has nociceptive and anxiolytic-like properties, as well as effects on memory in mice.[3][4]
Big dynorphin is a principal endogenous, agonist at the human kappa-opioid receptor.[1][5]
Principal endogenous agonists at κ receptor
Peptide sequence
YGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVT
Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-Lys-Arg-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr
| |||||
---|---|---|---|---|---|
μ-opioid (MOR) |
| ||||
δ-opioid (DOR) |
| ||||
κ-opioid (KOR) |
| ||||
Nociceptin (NOP) |
| ||||
Others |
|
![]() | This biochemistry article is a stub. You can help Wikipedia by expanding it. |